PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10018230m
Common NameCICLE_v10018230mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 317aa    MW: 35027.9 Da    PI: 8.0979
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10018230mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.81.1e-33172229259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +Dgy+WrKYGqK vk+s+fprsYYrCt+++C vkk+vers edp++v++tYeg+H h+
  Ciclev10018230m 172 EDGYRWRKYGQKAVKNSPFPRSYYRCTTQKCGVKKRVERSYEDPSIVITTYEGQHSHP 229
                      8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-35156231IPR003657WRKY domain
SuperFamilySSF1182907.72E-30163231IPR003657WRKY domain
PROSITE profilePS5081131.709166231IPR003657WRKY domain
SMARTSM007741.7E-39171230IPR003657WRKY domain
PfamPF031069.4E-27172229IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MRNGTKKDIY YRALFQPNVN IEAAARPGVS VAASSSSPDY VSPQEFDPSQ MNFTDCFHGL  60
MDYNSLEKAF TGMSPSSSEV FSSVEGNQKQ VKDLLIPNSS ISSSSAEAGG EEDSHSGKST  120
QKDDQALQSP KDHGHGGESS KKIEKKNNKK GEKKQKEPRV AFMTKSEVDH LEDGYRWRKY  180
GQKAVKNSPF PRSYYRCTTQ KCGVKKRVER SYEDPSIVIT TYEGQHSHPL PTTLRGNAAG  240
IFQSSSMLTP TPMNVSSFPQ DQWLGYSNFM PAMTHNQTAA PGPNAFATHP LDDHQLPDNF  300
GLLQDIAPSV FFKREP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-29161231777Probable WRKY transcription factor 4
2lex_A2e-29161231777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449634.10.0hypothetical protein CICLE_v10018230mg
SwissprotQ8VWJ25e-65WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLV4W9B80.0V4W9B8_9R
STRINGVIT_10s0003g02810.t011e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-52WRKY DNA-binding protein 28